PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00170.1_g00025.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 316aa    MW: 36561.2 Da    PI: 8.4031
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00170.1_g00025.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.62.2e-1699144147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg W + Ed +l+++v+ +G+ +W++Ia++++ gR++k+c++rw++ 
  Rsa1.0_00170.1_g00025.1  99 RGHWRPAEDAKLKELVAVYGPQNWNLIAEKLQ-GRSGKSCRLRWFNQ 144
                              899*****************************.***********996 PP

2Myb_DNA-binding59.76.4e-19151195147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              r ++T+eE+e+l +a++++G++ W+ Iar ++ gRt++++k++w+ +
  Rsa1.0_00170.1_g00025.1 151 RRAFTEEEEERLMQAHNLYGNK-WAMIARLFP-GRTDNSVKNHWHVV 195
                              678*******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.06994145IPR017930Myb domain
SuperFamilySSF466892.43E-2997192IPR009057Homeodomain-like
SMARTSM007175.0E-1498147IPR001005SANT/Myb domain
PfamPF002495.6E-1699144IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.8E-27100152IPR009057Homeodomain-like
CDDcd001671.94E-12102143No hitNo description
PROSITE profilePS5129426.923146200IPR017930Myb domain
SMARTSM007172.4E-15150198IPR001005SANT/Myb domain
PfamPF002491.0E-15151194IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-21153199IPR009057Homeodomain-like
CDDcd001671.29E-11153196No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MGMEIAHTNV SSPSITPHFP SSSHPLTNNI VMSKDHHRWM DQIASWQYFS LNNDKGHYYA  60
SQGEEDMKNP NRCNCSNSSK KERGDCGSCR NSLKASVSRG HWRPAEDAKL KELVAVYGPQ  120
NWNLIAEKLQ GRSGKSCRLR WFNQLDPRIN RRAFTEEEEE RLMQAHNLYG NKWAMIARLF  180
PGRTDNSVKN HWHVVMARKF REQSSVYTRR KTMITHKPLV TPNIHSCNDF EPTRSDLIHP  240
VGNDQNHLML PIPCFSGYDH GMFENQMMVD DYSSRTREAA TKFDLLSYTG KCEMLDESMN  300
EKKEPHFFDF LGLGTV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-32972005108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893531e-172AC189353.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB043L15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013699841.10.0PREDICTED: transcription factor MYB21-like
TrEMBLM4CJL00.0M4CJL0_BRARP; Uncharacterized protein
TrEMBLA0A078HT750.0A0A078HT75_BRANA; BnaC06g30790D protein
STRINGBra004394.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12102896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.11e-149myb domain protein 105